Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649695.1 | internal | 269 | 3-809(+) |
Amino Acid sequence : | |||
KGKGGGWSQATKLGLPIVFFFCSVFFLAGGFFGSLLLSQDINGARPRSRILESRDVVEEEEKIESVPRGETGEHFIHSIPSQVLSWKPRAVYFPRFATAEQCRSIIQMAKANLEPSTLAL RKGETTENTKGIRTSSGTFISSTEDKTGILSAIEQKIAKVTLIPASHGEAFNILRYEIGQRYLSHYDAFDPAEYGPQKSQRMASFLLYLSDVEEGGETMFPYENGVNMNGGYDYKKCVGL TVKPRQGDGLLFYSLFPNGTIDQMSLHGS | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 29,760.381 | ||
Theoretical pI: | 6.603 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 42.149 | ||
aromaticity | 0.108 | ||
GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.275 | ||
sheet | 0.242 |