Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649698.1 | internal | 210 | 1-630(+) |
Amino Acid sequence : | |||
LRWPTGRDVIWVAPVKITAQQVLSSGSLTKRMMMLEEDQISFHSDSHMFDGVEDYSHQIAEMIGLRTESSFIQAGIRTVLDVGCGYGSFGAHLLSKQLLTMCIASYEESGSQVQLTLERG LPAMIASFTSKQLPYPSLSFDMVHCAWCGIDWDQKDGAFLIEVDRVLRPSGYFVWTSPIANTRRTLRDKESQKKWTFVSSVAANLCWEML | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 23,653.879 | ||
Theoretical pI: | 5.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 46200 | ||
Instability index: | 42.849 | ||
aromaticity | 0.100 | ||
GRAVY | -0.058 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.219 | ||
sheet | 0.252 |