Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649702.1 | complete | 223 | 19-690(+) |
Amino Acid sequence : | |||
MGRRPARCYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMRGAFG KPQGTCARVSIGQVLLSVRCKDANGNHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRTDYIKWKQENRIVPDGVNAKLLGCHGPLANRQPGRAFLNGAVASA* | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 25,174.153 | ||
Theoretical pI: | 10.400 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27430 | ||
Instability index: | 37.051 | ||
aromaticity | 0.090 | ||
GRAVY | -0.514 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.229 | ||
sheet | 0.211 |