Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649710.1 | 5prime_partial | 148 | 2-448(+) |
Amino Acid sequence : | |||
RSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKRPGRPIETYIFAMFN EDRKSPEFEKHFGLFYPSKQPVYPINFA* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,587.449 | ||
Theoretical pI: | 6.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
Instability index: | 48.922 | ||
aromaticity | 0.142 | ||
GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.331 | ||
sheet | 0.203 |