Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649713.1 | internal | 201 | 3-605(+) |
Amino Acid sequence : | |||
TGHSYVTYGPLLNGATVVVFEGVPNYPDPGRCWDIVDKYKVTIFYTAPTLVRSLMRDGDEYVTRYSRQSLRVLGSVGEPINPSAWRWFFNVVGDSRCPISDTWWQTETGGFMITPLPGAW PQKPGSATFPFFGVLPVIVDEKGIEIEGECSGYLCVKNSWPGAFRTLYGDHERYETTYFKPFPGYYFSGDGCSRDKGWLSL | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 22,648.293 | ||
Theoretical pI: | 5.410 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 63370 63620 | ||
Instability index: | 32.097 | ||
aromaticity | 0.164 | ||
GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.294 | ||
sheet | 0.149 |