Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649718.1 | internal | 206 | 3-620(+) |
Amino Acid sequence : | |||
LAVAQVPANETFKIVNEGEFGEYIIEYDANYRIISTDTMSFYNYPFRLCFYNTTPNAFIFAIRAGLPRDEDLMRWVWNANRYHPVRENAVLSFGTNGNLVLTDVDGTIAWQTNTANKGVT GIKMLGNGNLVLHDKNGKYVWQSFDYPSDTLLVGQSVRLNGINKLVSRKSDLDGSDGPYSLVIEPAGFNMYYTFDGKPLRYGGWRS | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 23,282.894 | ||
Theoretical pI: | 5.705 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
Instability index: | 31.086 | ||
aromaticity | 0.141 | ||
GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.282 | ||
sheet | 0.199 |