Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649722.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
FLLYFFSPLSAFLAPNSESLKINPMNPSALTSANQNAYEPPAKALRRLLESPGIYQGPCCFDALSAKLVEKAGFKFSISSGFSISAARLGLPDAGMISYGEMVDQGRQITQAASIPIIGD GDNGYGNAINVKRTIKGFIHAGFAGILLEDQVSPKACGHTPGRKVVSREQAVMNIKAAIDARKESGSDIVIVARTDSRQAVSLEEALWRCKAFADAGADVLFIDA | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 23,929.097 | ||
Theoretical pI: | 7.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 32.109 | ||
aromaticity | 0.080 | ||
GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.271 | ||
sheet | 0.280 |