Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649724.1 | 5prime_partial | 252 | 3-761(+) |
Amino Acid sequence : | |||
KVQFRAANCHLALGEVEDAIKYFKKILPSGDDICLDRKTVIEASTGLQKAQQVADYLDCCAELLCQKTSKDAENALQIIAEALLLSPYSEKLFQMKAEALLVLRKYSELIQLCEKSLDSA EKNSASQSDEGWKINGSESINISFAKLWRWCMISKSYFYLGKLEEALDFLEKLEQAVSVVQKYGSNALESSIALAVTVRELLRHKTAGNEAFQSGRHLEAVEHYTSALSCSIESRPFAAI LLFAIVLLHTKL* | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 16,928.021 | ||
Theoretical pI: | 6.207 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 62.171 | ||
aromaticity | 0.123 | ||
GRAVY | -0.286 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.185 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649724.1 | complete | 146 | 573-133(-) |
Amino Acid sequence : | |||
MIPEHYFHIFVQQILLAQASQGNQELPQAFLDKNKTWKSCTIAIALQKKYLCFQIHLSSSPHHFVKQNFFQQSQETSHTVESTQSTFGALIEPQLSFEIASLSMDLVTELQQLFAKHFLR PWMFFDTKAQHSNQDNQPLAELFANQ* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,928.021 | ||
Theoretical pI: | 6.207 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 62.171 | ||
aromaticity | 0.123 | ||
GRAVY | -0.286 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.185 | ||
sheet | 0.260 |