Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649725.1 | internal | 219 | 2-658(+) |
Amino Acid sequence : | |||
FKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQVHNSWLFFPWHRYYLYFYERILGKLIDDPSFAIPYWNWDSSTGMVLPEF YADLKSPLYDSLRDAKHQPPTLVDLDYNLVDPNVSREQQITSNLTIMYRQMVSNAKTSLLFLGSPYRAGDEPDPGAGSMENIPHGPVHLWTGDRTQPNV | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 25,049.005 | ||
Theoretical pI: | 5.275 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48360 48485 | ||
Instability index: | 45.949 | ||
aromaticity | 0.128 | ||
GRAVY | -0.443 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.256 | ||
sheet | 0.228 |