Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649727.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
NTVDTGRTVVCTIHQPSIDIFEAFDELLLMKRGGQVIYSGPLGRNSHKVVEYFEAIPGTPKIKDKYNPATWMLEVSSIAAEVRLGIDFAEYYKSSSLHQRNKMLVKELSTPAPGAKDLYF ATQYSQSIIGQFKSCLWKQWITYWRSPDYNLVRYFFTLAAALMVGTIFWRVGTKRDSSSDLTVIIGAMYAAVLFVGINNCSTVQPVV | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 23,298.608 | ||
Theoretical pI: | 8.903 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44015 | ||
Instability index: | 36.249 | ||
aromaticity | 0.126 | ||
GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.222 | ||
sheet | 0.213 |