Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649729.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
LPLFLVFAVPILLLFLLKPSHKNLPPGPFSWPLIGTLLPKLKKQPHLELSKLAQTYGPLMLLKFGVEPVVVASTHEAAMEVLKIHDRVLSGRFAPHSVRIKGYFEHSMVWADCTEYWKMV RKIWRTELFSTKMLEAQASVRKEKVKELMGFLRRKEGEAVKFADLIFGCILNILGSVIFNQNVYDYDDKSDNELGMKGMIRQLMIPATIPNLADLYPILGDSDFQGLRKASAECVNRMNE SWAA | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,730.471 | ||
Theoretical pI: | 9.154 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
Instability index: | 31.751 | ||
aromaticity | 0.098 | ||
GRAVY | 0.047 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.209 | ||
sheet | 0.311 |