Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649733.1	internal	194	1-582(+)
Amino Acid sequence :
VRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTD PANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKRPGRP
Physicochemical properties
Number of amino acids:		194
Molecular weight:		21,292.916
Theoretical pI:		9.360
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21890 21890
Instability index:		40.091
aromaticity		0.103
GRAVY		-0.129
Secondary Structure Fraction
Helix		0.340
turn		0.320
sheet		0.186