Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649736.1 | internal | 239 | 3-719(+) |
Amino Acid sequence : | |||
SSLVLNQQYCPPPPPVTLSVVSRIKNGNSGWLNTVSNAAASATGKISVPSGALAAAFHNSLPQSPLSIPLNASALEHLLVYSPSGHLIQHELLPCMGVEPNDSIASTGSTPLVQMQDEEL RVKVEPIQWWYVCRRSDAPEREESISRITFNKQETSNTLLNNSDCEDSGEKYVVELNHSTGVKTFAKPHERPHWYLSNAEVQISSGRIPLWQKPEVSFHVINEMNYSRDNTCGEVEIEK | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 26,386.274 | ||
Theoretical pI: | 5.477 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
Instability index: | 48.292 | ||
aromaticity | 0.063 | ||
GRAVY | -0.407 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.322 | ||
sheet | 0.243 |