Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649749.1	3prime_partial	167	3-503(+)
Amino Acid sequence :
MAFENRTILVTGGAGFIGTHTVVQLLNEGFRVSIIDNLDNSVEEAVQRVRDLVGPELSERLQFHLGDLRNKNDLENLFAQTKFDAVIHFAGLKAVGESVAKPRRYFDNNLVGTINLYETM AKYDCKKMVFSSSATVYGQPEKIPCIEDFELKAMNPYGRTKLFLEEI
Physicochemical properties
Number of amino acids:		167
Molecular weight:		18,823.289
Theoretical pI:		5.433
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7575
Instability index:		31.681
aromaticity		0.096
GRAVY		-0.178
Secondary Structure Fraction
Helix		0.335
turn		0.210
sheet		0.275