Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649751.1	internal	141	2-424(+)
Amino Acid sequence :
PKFCKSELPPNGLNNIHDYSRVSVRRSLSSALKFQALVDRYLAKKSTLSRSATDALQVCQFLAALNVDYLQSTSNVLQAITNTLSTIKVEDLQTLLSAILTNHQTCLDCLQSTASAWSIR NGLSMPLSNGTKLYSVSLALF
Physicochemical properties
Number of amino acids:		141
Molecular weight:		15,439.546
Theoretical pI:		9.229
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11710
Instability index:		45.911
aromaticity		0.064
GRAVY		0.045
Secondary Structure Fraction
Helix		0.326
turn		0.255
sheet		0.277