Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649753.1 | internal | 198 | 3-596(+) |
Amino Acid sequence : | |||
SPPSSSSFILCFWDEMASNGEGNAEFSFANGPAGTGWNGLAKIQTNRRHNGICHDDSTTPVKAQTIDELHSLQKKKSAPTTPIKDADGTFAIISEEERQMLQLQSISASLASLTRETGPK LVRGDQARKVEAAKVSNVVDYTPAISVSDSSLKSTQVLHNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRSPR | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 21,155.342 | ||
Theoretical pI: | 6.884 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 40.222 | ||
aromaticity | 0.056 | ||
GRAVY | -0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.227 | ||
turn | 0.293 | ||
sheet | 0.247 |