Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649757.1 | complete | 181 | 45-590(+) |
Amino Acid sequence : | |||
MRRSEYLSLFRTEEAKGRTTYRLFSSSIFVGIFATWIYRLTYVPDDSSERWVWMLLFAAELWFCLFWVLSQSLRWNRIHRYTYKDRLSHRCEEKLPGVDVFVCTADPTIEPPMLVINTVL SLMAYNYPPEKLSVYLSDDGGSDLTFYALLEASHFSKHWIPFCKNFNIEPRSPAAYFSAIF* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 21,391.355 | ||
Theoretical pI: | 6.895 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54890 55140 | ||
Instability index: | 58.908 | ||
aromaticity | 0.177 | ||
GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.210 | ||
sheet | 0.254 |