Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649761.1 | internal | 180 | 2-541(+) |
Amino Acid sequence : | |||
ASKMPQGDYIELHRKRHGYRLDHFERKRKKEAREVHERSAKAQKALGIKGKMFAKKRYAEKALMKKTIAMHEESSSRRKVDDEVHEGAVPAYLLDRESTTRAKVLSNTIKQKRKEKAGKW EVPLPKVRPVAEDEMFRVIRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPSGLR | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 12,588.663 | ||
Theoretical pI: | 10.099 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 50.085 | ||
aromaticity | 0.064 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.266 | ||
sheet | 0.266 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649761.1 | 3prime_partial | 109 | 213-539(+) |
Amino Acid sequence : | |||
MRNHQVEGRWMMKFMKELSLHIFWIVNQPHAQRYLATQSSRKGKRKLVNGKSPCPRLDLLLRMKCLGSLELVKGKLSNGKEWSPRPLLSDQDLQGNLPSMSDSFVHQAC | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,588.663 | ||
Theoretical pI: | 10.099 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 50.085 | ||
aromaticity | 0.064 | ||
GRAVY | -0.552 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.266 | ||
sheet | 0.266 |