Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649770.1	internal	193	2-580(+)
Amino Acid sequence :
IEDHPFEEYDEPPVFGKKTIFTARSSGGQDQWAQCDSCSKWRRLPVDVLLPPKWMCIDNSWDPKRCVCSAAEELTPMERENLLRLDRDLKKRRIAVSQKSIQENEPSGLDALATAAVLGE ERGDSGATSVATTTKHPRHRPGCTCIVCIQPPSGKGPKHKPTCTCNVCMTVKRRFKTLMMRKKKRQSEAEGAQ
Physicochemical properties
Number of amino acids:		193
Molecular weight:		21,682.699
Theoretical pI:		8.988
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 24115
Instability index:		64.802
aromaticity		0.047
GRAVY		-0.739
Secondary Structure Fraction
Helix		0.197
turn		0.223
sheet		0.228