Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649797.1 | internal | 233 | 3-701(+) |
Amino Acid sequence : | |||
PGVSSLHDNKDDASLMWLRGDMGDRGFQSLNFQGLGISPWLQQRIDPSLLRNDHDQQYQAIAAAALQDIRGGDPLKQQYLQFQQPFQYLQQSCAQNPVLQQQLIQQTLPQQILHGQSANL SDNQPRHLVPRALDGQQKPQAQQQQQTYQEAFQIPNNQFQQSSPLPAPLSQKPEFIDSNITFSSALNPSNIQSMLGSVCSEGNGNIPLFSRINQSMMSEPQQHQLWVPKFSYP | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 26,274.960 | ||
Theoretical pI: | 5.641 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 76.378 | ||
aromaticity | 0.077 | ||
GRAVY | -0.723 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.300 | ||
sheet | 0.202 |