Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649814.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
NLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVST AIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATS IDNARTYNQNLINHV | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 28,224.632 | ||
Theoretical pI: | 8.084 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 47.883 | ||
aromaticity | 0.098 | ||
GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.314 | ||
sheet | 0.196 |