Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649816.1 | 3prime_partial | 239 | 30-746(+) |
Amino Acid sequence : | |||
MEKALNRQQVLLQHLRPSASLSQLGDESAISASICLAGDSSAYQRTSVFGDDVVIVAAYRTPICKSRRGGFKDTFADDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMA AFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTLNQVAWDSTVNPKAQTLQKAQDCLLPMGITSENVAQRYGVTRQEQDQAAVDSHRKAAAATASGKFKDEI | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 25,366.418 | ||
Theoretical pI: | 5.759 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 41.710 | ||
aromaticity | 0.054 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.218 | ||
sheet | 0.276 |