Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649816.1	3prime_partial	239	30-746(+)
Amino Acid sequence :
MEKALNRQQVLLQHLRPSASLSQLGDESAISASICLAGDSSAYQRTSVFGDDVVIVAAYRTPICKSRRGGFKDTFADDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMA AFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTLNQVAWDSTVNPKAQTLQKAQDCLLPMGITSENVAQRYGVTRQEQDQAAVDSHRKAAAATASGKFKDEI
Physicochemical properties
Number of amino acids:		239
Molecular weight:		25,366.418
Theoretical pI:		5.759
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13200
Instability index:		41.710
aromaticity		0.054
GRAVY		-0.091
Secondary Structure Fraction
Helix		0.264
turn		0.218
sheet		0.276