Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649827.1 | 5prime_partial | 164 | 1-495(+) |
Amino Acid sequence : | |||
LESLHLDRNRLTGPIPESFGRFSGSLKYLVLSHNQLSGRIPATLRNVDLDTIDLSRNTLEGDASMLFGEEKSLRDVDLSRNVLEFDMSTLRFPKKTLVALDLNHNRIYGSIPRQLTKVGT LLGFNVSYNRLCGEIPQGGKLQSFDSSTYFHNRCLCGAPLPKCK* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 11,515.705 | ||
Theoretical pI: | 10.142 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 76.312 | ||
aromaticity | 0.019 | ||
GRAVY | -0.950 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.282 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649827.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
RIPPPRSQPSDRTNPRILRSVLRIPEVPRAVAQPALRSDPRDAEERGLGHDRSVEEHVGGRRIDAVRRGEIAEGRRSVEKRLGIRYVDAEVSEEDFGSVGSKS* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,515.705 | ||
Theoretical pI: | 10.142 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 76.312 | ||
aromaticity | 0.019 | ||
GRAVY | -0.950 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.282 | ||
sheet | 0.223 |