Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649854.1 | 3prime_partial | 235 | 41-745(+) |
Amino Acid sequence : | |||
MASLPLLSMVLCFLSLSMKVSYAALPSERYWQSLLPNTPIPKAVQDLLPPAGKINKPASIGVQPTSIPQYARYASEEQLRQKDYSYFFLEKDLHPGTKLNLHFTKTTTETAFLPRKVAES IPFSSTKLPDILNRFSVKPGSREAEVIKQTIEDCESPALQGEDRYCATSLESMVDYCAAKLGKNAKVAATKVNDDKITPKQQYTIEEGVKEMGGDKSMVCHNQNYAYAVFYCHLT | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 26,227.843 | ||
Theoretical pI: | 8.115 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23755 | ||
Instability index: | 48.214 | ||
aromaticity | 0.089 | ||
GRAVY | -0.333 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.230 | ||
sheet | 0.272 |