Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649873.1 | 5prime_partial | 144 | 1-435(+) |
Amino Acid sequence : | |||
AMETAKTVKDVSPHDFVKAYSAHLKRSGKMELPHWTDIVKTATFKELAPYDPDWYYVRAASMARKIYLRQGIGVGGFRKIYGGRKRNGSRPPHFCKSSGAIARHILQQLEKMNIVEIDTK GGRRITSSGQRDLDQVAGRIVVAP* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,155.466 | ||
Theoretical pI: | 10.129 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 48.871 | ||
aromaticity | 0.083 | ||
GRAVY | -0.521 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.215 | ||
sheet | 0.201 |