Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649875.1 | internal | 129 | 3-389(+) |
Amino Acid sequence : | |||
LISLVGVALAQDLTSLISEATFNEMLKHRGEGNCRGGFYTYNAFITAARSFSGFATTGSTDDRKREIAAFFGQTSHETTGGWPAAPDGPFAWGYCFVEEQGNPGDLCQPSPQWPCAPGKK YYGRGPIQI | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 12,129.711 | ||
Theoretical pI: | 7.937 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 49.427 | ||
aromaticity | 0.061 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.298 | ||
sheet | 0.263 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649875.1 | 5prime_partial | 114 | 389-45(-) |
Amino Acid sequence : | |||
NLDRSSAVIFLAWSTGPLRTRLTEISGIALFFNEAVTPCKWSVRCSRPPSSSFVGSLAKESCDLPLTIVGAASGSKATKRPRSGYESVVSVEPTTTITLASMLQHLIESGLADE* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,129.711 | ||
Theoretical pI: | 7.937 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 49.427 | ||
aromaticity | 0.061 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.298 | ||
sheet | 0.263 |