Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649877.1 | internal | 150 | 1-450(+) |
Amino Acid sequence : | |||
RPSPRPQSNTTAFSGKPQLQYQEHPLKPLGTIDHTKNDKAHARASDGLPLPLYLFNGLFFTLFFSVAYFLLIRWREKIRNSMPLHVISLSEMLAIFSLIISVIYLLAFFGIDFVQSFITR SSNDAWEMDEEVNEGFIIQEDSRIGPCAVA | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 17,080.447 | ||
Theoretical pI: | 6.074 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 41.801 | ||
aromaticity | 0.127 | ||
GRAVY | 0.046 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.247 | ||
sheet | 0.253 |