Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649879.1 | 3prime_partial | 160 | 67-546(+) |
Amino Acid sequence : | |||
MGSMSALIYLLASMLVALLHFASAQSSPQDFLVPHNAARAQVRVPPMVWDETVAAYARNYANQRAGDCNLVHSGGPYGENLAKSTGDLTAAGAVGLWVRERPFYNYNSNSCVGGECLHYT QVVWRNSVRLGCASVRCRNGGTFVTCNYAPRGNIIGQRPY | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,375.519 | ||
Theoretical pI: | 9.017 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
Instability index: | 44.393 | ||
aromaticity | 0.100 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.294 | ||
sheet | 0.250 |