Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649882.1 | internal | 222 | 1-666(+) |
Amino Acid sequence : | |||
LPHTLTTTIVSSNSSLSSSCSLFHPKTSQVNLSGKQIRQRRLVVPRNVTCSSNHKFGENRSSNSSINDHHEEYSNALVDRRNVLLGLGAGLYGFAGLNAADRLAVGAPIMPPDLSKCGPA DLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADYPRNFTQQANVHCAYCDGAYDQIGFPDLEIQIHNSWLFFP | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 24,241.221 | ||
Theoretical pI: | 8.471 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16305 | ||
Instability index: | 50.227 | ||
aromaticity | 0.077 | ||
GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.306 | ||
sheet | 0.225 |