Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649888.1 | 5prime_partial | 157 | 3-476(+) |
Amino Acid sequence : | |||
VGDSIPDGTLSWFDESDELQQVSVHSLAAGKKVILFGVPGAFTPTCSLKHVPGFIERAEELKGKGVDDILLVSVNDPFVMKEWAKTYPDNKHVKFLSDGSASYTHALGLELDLSDKGLGT RSRRFALLVDDLKVKVANLESGGEFTVSSAEEIIKAL* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 12,336.315 | ||
Theoretical pI: | 10.139 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 81.248 | ||
aromaticity | 0.095 | ||
GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.190 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649888.1 | 3prime_partial | 105 | 317-3(-) |
Amino Acid sequence : | |||
MCVARRSIRKEFNMLVIWVRFRPFLHHKRIVHANKQDIIYALPFQLFCTFDESWDMLQAASGGKSAGNSKQNDLLACGERMHRHLLQLIRLIEPRQSPIRNAVSY | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,336.315 | ||
Theoretical pI: | 10.139 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 81.248 | ||
aromaticity | 0.095 | ||
GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.190 | ||
sheet | 0.257 |