Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649896.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
DTQRHRLGPNYLPFPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPIPPNVCTGKREKCIIDKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPRVTHEIRSVWIS YWSQADKSLGQKLATRLNVRPSI* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 17,096.053 | ||
Theoretical pI: | 9.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 53.282 | ||
aromaticity | 0.112 | ||
GRAVY | -1.056 | ||
Secondary Structure Fraction | |||
Helix | 0.259 | ||
turn | 0.259 | ||
sheet | 0.168 |