Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649900.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
IHSFGTWEQPAEIKAKVNYALCFGGQKRWASRAAVAEDDNKISIGPQNRGKGDDAKDPGVVYYGPISSTIKKVKLLSLSTCCLSVSLGPVITFMTSPEMNVILKGAVASSVIFLSATTTA ALHWFVSPYIHKLRWQPGSDT | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,243.387 | ||
Theoretical pI: | 9.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 42.991 | ||
aromaticity | 0.092 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.312 | ||
turn | 0.270 | ||
sheet | 0.206 |