Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649908.1	internal	107	3-323(+)
Amino Acid sequence :
SLLFLTKFLFGTRKHYPPSPAGAIPIVGHLRLVFTPLHRTLQTLSQRYGQYLFLRLGSRRVLVLSSPAAIEECINKNDLAFANRPRTVAGDYLSYNYTVLALSNYNH
Physicochemical properties
Number of amino acids:		107
Molecular weight:		12,121.901
Theoretical pI:		10.164
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		10430 10430
Instability index:		56.108
aromaticity		0.121
GRAVY		0.007
Secondary Structure Fraction
Helix		0.383
turn		0.252
sheet		0.262