Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649908.1 | internal | 107 | 3-323(+) |
Amino Acid sequence : | |||
SLLFLTKFLFGTRKHYPPSPAGAIPIVGHLRLVFTPLHRTLQTLSQRYGQYLFLRLGSRRVLVLSSPAAIEECINKNDLAFANRPRTVAGDYLSYNYTVLALSNYNH | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,121.901 | ||
Theoretical pI: | 10.164 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 56.108 | ||
aromaticity | 0.121 | ||
GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.252 | ||
sheet | 0.262 |