Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649915.1 | internal | 144 | 1-432(+) |
Amino Acid sequence : | |||
QPQIQRIANGDRSSILSADPISEFLTSSGTSAGERKLMPTIQEELDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKTRPYDPYMVYTSPNEVI LCTDSFQSMYTQMFCGLYHREEVL | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,433.704 | ||
Theoretical pI: | 6.924 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 15025 | ||
Instability index: | 54.947 | ||
aromaticity | 0.111 | ||
GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.250 | ||
sheet | 0.243 |