Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649916.1 | 5prime_partial | 153 | 517-56(-) |
Amino Acid sequence : | |||
VRIHSPVSGKAALLGLKLFLFGVGNTIKFMDFTLQLDHTSTVCSCFDLNLVCCRLVVDAQCSSFNHAVLARIPLFVQLLYSFPHMLERNRFGEMVFLDAPSAPISFNKGTLLHYSGHNLF CKFVHVKHGSLEESCRRHWRFKLSMVSVNSHFN* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,578.671 | ||
Theoretical pI: | 5.814 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13535 | ||
Instability index: | 39.812 | ||
aromaticity | 0.093 | ||
GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.192 | ||
sheet | 0.325 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649916.1 | 3prime_partial | 151 | 65-517(+) |
Amino Acid sequence : | |||
MGVHTYHAEFESPVSPARFFKAAVLHMHELAEKIMPAVVKKGALVEGDGCAGSIKEYHFTEAIPFKHVRERVEELDKEGYACKYSVIEGGTLGIYYKSATNKVKIEAGANGGSVIKLEGE IHELDGVAYPEEEKLKTKEGSLATYRAVDAY | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,578.671 | ||
Theoretical pI: | 5.814 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13535 | ||
Instability index: | 39.812 | ||
aromaticity | 0.093 | ||
GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.192 | ||
sheet | 0.325 |