Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649918.1 | internal | 142 | 2-427(+) |
Amino Acid sequence : | |||
AMKRGDWYRTKDLVLKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERLNLERARKE AYQAGFLGKNACGSGYDFDVHI | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 16,116.369 | ||
Theoretical pI: | 10.532 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 35.437 | ||
aromaticity | 0.106 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.246 | ||
sheet | 0.141 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649918.1 | internal | 142 | 427-2(-) |
Amino Acid sequence : | |||
NMNVKIITRTTSILAQKSSLVSFFPRSLKVQTLINIFSPYIDVSSSGPHSHSCNQATFKQFVWIVPHNFSVFTGARFTLISIDNKVGRTTIRYLRHEGPFETRRKTSTTTATKTRLLHFI DNPVRALEYQVFCSIPVASLHS | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 16,116.369 | ||
Theoretical pI: | 10.532 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 35.437 | ||
aromaticity | 0.106 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.246 | ||
sheet | 0.141 |