Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649931.1 | internal | 106 | 320-3(-) |
Amino Acid sequence : | |||
IHQRFRLSPLAYDPPGQLDVLGHNCDTLSMNCTQVGVLEQTHQVSLSCFLQRQHGMALETQVRLKILCNFTNKPLEWQLPDQELSALLILTNFTQSNSSRAISVGL | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,540.400 | ||
Theoretical pI: | 10.158 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 41.055 | ||
aromaticity | 0.071 | ||
GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.101 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649931.1 | 5prime_partial | 99 | 3-302(+) |
Amino Acid sequence : | |||
KPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIIGERA* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,540.400 | ||
Theoretical pI: | 10.158 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 41.055 | ||
aromaticity | 0.071 | ||
GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.101 | ||
sheet | 0.313 |