Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649935.1 | internal | 135 | 2-406(+) |
Amino Acid sequence : | |||
FHPKTSQVNLSGKQIRQHRSIVPRNVTCSSNRKSGENRSSSSINDHHEEYPNALVDRRNMLLGLGAGLYGFAGLTVADRLAAGAPIIPPDLSKCGPADLPAGAKPTDCCPPENFKNIVDF QLPSPSSPMRVRPAA | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,470.246 | ||
Theoretical pI: | 9.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 50.418 | ||
aromaticity | 0.044 | ||
GRAVY | -0.481 | ||
Secondary Structure Fraction | |||
Helix | 0.222 | ||
turn | 0.356 | ||
sheet | 0.215 |