Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649937.1	internal	114	1-342(+)
Amino Acid sequence :
PGGGQQLNQGQSWTFNVANGTRTGRIWARTKCNFDAPGGTTTRPRCETGDCGAVLRCQTDGATPKTLVEYALNQFNNMDLYDISLIDGFNVPVELSPVTTTATCRSVRCAADIT
Physicochemical properties
Number of amino acids:		114
Molecular weight:		12,247.540
Theoretical pI:		6.596
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14355
Instability index:		28.330
aromaticity		0.070
GRAVY		-0.375
Secondary Structure Fraction
Helix		0.228
turn		0.263
sheet		0.175