Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649938.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
SFSFTDACLGSSDASGSGLGGWKPCLYYARGYCKNGASCKFLHGLPDSPDSGSMVGSPAKLDVMEQCQELLLRSKTQQQQQQQQQHQRLNPASQIFSPAAASLPYATASTKCINFLLQQH QYEAQQRASAAASLMLGEDMHKFSRSRIEKNELLNNGAMLSNAGSRQIYLTFPADSTFREEDVSNYFSIYGPVQDVRIPFQQKRMFGFVTFVYPETVKLILAKGNPHFVCDARVLVKPYK EKGK | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,102.451 | ||
Theoretical pI: | 8.909 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20775 | ||
Instability index: | 56.337 | ||
aromaticity | 0.102 | ||
GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.262 | ||
sheet | 0.242 |