Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649941.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
ILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDSSRVKEYLPITGLADFNKLSAKLILGADSPAIQENRVATVQCLSGTGSLRVGAEFLARHYHQHTIYIPQPTWG NHPKVFTLAGLSVKYYRYYD | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,484.593 | ||
Theoretical pI: | 9.352 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
Instability index: | 35.894 | ||
aromaticity | 0.093 | ||
GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.243 | ||
sheet | 0.243 |