Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649945.1 | internal | 168 | 2-505(+) |
Amino Acid sequence : | |||
LASLTRETGPKLVRGDPARKVEAAKVSNVVDYIPAISVSDSSLKSTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRSPRDKRVVRDEATEDELWWGKGSPNIEMDEHTFL VNRERAVDYLNSLDKVFVNDQFLNWDPEHRIKVRIVSARAYHSLFMHN | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,919.086 | ||
Theoretical pI: | 7.163 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 29.033 | ||
aromaticity | 0.083 | ||
GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.232 | ||
sheet | 0.256 |