Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649947.1 | 3prime_partial | 108 | 58-381(+) |
Amino Acid sequence : | |||
MRTGELKEWDRIYDYDFYNNLGDPDKGRDYVRPVLGGSITYPYPRRGRTGRKSTRTDPRTERRLPILRLDIYVPRDERFGHLKMSDFLAHGLKSLGQVLVPELKSFFD | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,765.361 | ||
Theoretical pI: | 9.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 38.258 | ||
aromaticity | 0.120 | ||
GRAVY | -0.876 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.231 | ||
sheet | 0.185 |