Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649951.1 | internal | 159 | 1-477(+) |
Amino Acid sequence : | |||
VATMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR DAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQ | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,064.500 | ||
Theoretical pI: | 5.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 59.981 | ||
aromaticity | 0.054 | ||
GRAVY | -0.128 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.188 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649951.1 | 3prime_partial | 149 | 447-1(-) |
Amino Acid sequence : | |||
MQTKLVCDFSSIHCIRQILLVGEDKKHSIPQFILIQHSVKLIPCFYNSIPIIAVNNKDETLCILEIVAPQWSDLVLATNIPDSKADILVLHCLNIETDGWDSGHDLAKLQLVQDRRFTGS IESDHQNPHLLLREQSTEELRKRQPHCCY | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 17,064.500 | ||
Theoretical pI: | 5.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 59.981 | ||
aromaticity | 0.054 | ||
GRAVY | -0.128 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.188 | ||
sheet | 0.221 |