Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649952.1 | internal | 151 | 3-455(+) |
Amino Acid sequence : | |||
LVLSRCHLHGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLAPGWYTEKGIELILSTEIVKVDLASKSLVSAAGLTFKYDTLLIATGS TVIRLTDFGVQGADAKNIFYLREIDDADKLI | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 11,296.794 | ||
Theoretical pI: | 9.915 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 49.540 | ||
aromaticity | 0.103 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.336 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649952.1 | complete | 107 | 349-26(-) |
Amino Acid sequence : | |||
MSKVSYLKVNPAALTRDFEARSTFTISVLRINSMPFSVYHPGASLSPPLPTQTWKPGSLAGDSGKRYALLRAGRSYGATASFEIIASSPGLTPCFANSLAAYPAATP* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,296.794 | ||
Theoretical pI: | 9.915 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 49.540 | ||
aromaticity | 0.103 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.336 | ||
sheet | 0.271 |