Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649954.1 | 3prime_partial | 224 | 48-719(+) |
Amino Acid sequence : | |||
MIITFPSFLIFSITLASFLFCVANAATFEVTNNCGYPVWAAAVPGGGQLLNQGETWRFDVNPGTTQARIWGRTGCNFDGNGRGRCQTGDCNGLLRCEAYGQPPNTLAEYALNQFGNMDFF DISLVDGFNIPMEFSPTTGNCRGIKCNADINGQCPNELKTDGGCHNPCTVFKTDEYCCNSGNCGPTPLSKFFKERCPDAYSYPKDDPTSTFTCPAGTNYKVVFC | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 12,426.298 | ||
Theoretical pI: | 7.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 55.482 | ||
aromaticity | 0.053 | ||
GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.239 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649954.1 | 5prime_partial | 113 | 719-378(-) |
Amino Acid sequence : | |||
AKDDLVVGTSGASEGTSRIILRVTVSIWAPFLKELGQRSRSTVSRIAAILIGLKHSAWIMASTICFQLIRALPIDISIALNSPAIPSSWAELHRNIEPINERYVEEIHVPELV* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,426.298 | ||
Theoretical pI: | 7.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 55.482 | ||
aromaticity | 0.053 | ||
GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.239 | ||
sheet | 0.274 |