Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649957.1	internal	133	1-399(+)
Amino Acid sequence :
SIYSPNMLFDQDRCRQEIAEMIIMHEYPLHMVEHPAFISFVQNLQARFNMVNFNTVQGDCIAIYLREKQDLVRLLVGLPGRISLTLDLWMSNNTLGYIFLTGHFIDSDWKLSRRLLNVVM VPSLQSGDALSHA
Physicochemical properties
Number of amino acids:		133
Molecular weight:		15,355.655
Theoretical pI:		5.881
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17085
Instability index:		50.833
aromaticity		0.098
GRAVY		0.105
Secondary Structure Fraction
Helix		0.376
turn		0.218
sheet		0.271