Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649965.1	internal	191	1-573(+)
Amino Acid sequence :
LSLLLVAINALATLAQGLPRAVLDTAGRPLRTGTQYYIIRRSAPGINGPGLTLVRPNGSCPLYVGLQGKTIGSSNGLPVTFLPFVSDETVIRESSDFSVSFVASTTTCPESTTDWAIDQA SDPNMSGRTLITTRRENQPSDFFRILRDGRETYKLHYCPTEACPQCRFRCGDIGLSRNEGNLLAVHVPALP
Physicochemical properties
Number of amino acids:		191
Molecular weight:		20,749.333
Theoretical pI:		10.564
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31970 32220
Instability index:		54.241
aromaticity		0.053
GRAVY		-0.642
Secondary Structure Fraction
Helix		0.241
turn		0.305
sheet		0.176

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649965.1	5prime_partial	187	573-10(-)
Amino Acid sequence :
RKSRNMHGQEIPFVPRKTNITTPKATLRTGLSWAIMQLIRLSSISQDPEKITGLVLPPRRDQCPATHVRIRSLINGPVCGRLRASRCGSHKADREVARFPYNSLIGDEWEEGDWKTVGRS NCLALQPNVQWARTVWSNQGQARSINPGSTSAYDIVLGSGSKRSSCSVEHRTGQALGKRSQSVNGYK*
Physicochemical properties
Number of amino acids:		187
Molecular weight:		20,749.333
Theoretical pI:		10.564
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31970 32220
Instability index:		54.241
aromaticity		0.053
GRAVY		-0.642
Secondary Structure Fraction
Helix		0.241
turn		0.305
sheet		0.176