Acc_NO	ORF type	length	start-end position (strand +/-)
>JG649981.1	internal	146	1-438(+)
Amino Acid sequence :
LLLAALFQVATAADTHVVLGRIGWTFPPNPNAYRNWAANEDFEVNDTLVFNFPTGVHDVAKVTKAAYDSCTTTNPISIHRTGPANITLDANGIHYFICTFAGHCSAGQKLAISVGTDSGA IPPSSGDNRAPSGSVTPTVNNTAPSG
Physicochemical properties
Number of amino acids:		146
Molecular weight:		15,211.734
Theoretical pI:		5.866
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		30.134
aromaticity		0.082
GRAVY		-0.021
Secondary Structure Fraction
Helix		0.267
turn		0.308
sheet		0.199