Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649981.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
LLLAALFQVATAADTHVVLGRIGWTFPPNPNAYRNWAANEDFEVNDTLVFNFPTGVHDVAKVTKAAYDSCTTTNPISIHRTGPANITLDANGIHYFICTFAGHCSAGQKLAISVGTDSGA IPPSSGDNRAPSGSVTPTVNNTAPSG | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,211.734 | ||
Theoretical pI: | 5.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 30.134 | ||
aromaticity | 0.082 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.308 | ||
sheet | 0.199 |