Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG649994.1 | internal | 266 | 1-798(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGFGNCCF | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 29,298.175 | ||
Theoretical pI: | 8.960 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26485 | ||
Instability index: | 46.701 | ||
aromaticity | 0.105 | ||
GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.301 | ||
sheet | 0.207 |